PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID BGIOSGA011584-PA
Common NameOsI_09710
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family Trihelix
Protein Properties Length: 527aa    MW: 55598.2 Da    PI: 6.2508
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
BGIOSGA011584-PAgenomeRISView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix108.54.3e-34219304187
          trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqlea 87 
                       rW+k ev+aLi++r+e+e+r++++  k+plWe++s+ mr+ g++rs+k+Ckekwen+nk++kk+ke++kkr +e+s+tcpy++ql+a
  BGIOSGA011584-PA 219 RWPKAEVHALIQLRTELETRYQDSGPKGPLWEDISAGMRRLGYSRSSKRCKEKWENINKYFKKVKESNKKR-PEDSKTCPYYHQLDA 304
                       8*********************************************************************8.99***********85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500907.201212276IPR017877Myb-like domain
SMARTSM007170.0051216278IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.608.1E-4217275IPR009057Homeodomain-like
PfamPF138371.2E-23218305No hitNo description
CDDcd122033.38E-29219283No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 527 aa     Download sequence    Send to blast
MACGGVRDDD GRRELLVGAD TEETAEEGPG GSGKRRGGGG IGGGGGGGKA MRMFEGLMRQ  60
VMERQEAMQQ RLLEAIERRD QERMIREEAW RRQEVARLAR EQDALAQERA IAASRDAAVI  120
SFIQRVTGQS IAAVPPPPLQ PTPVASAAPP PPPQHHHQQT PPPIQVQPHH IMPMTPQPQL  180
QPPQPQSKEA NTVVRAAPPP QEQHDTAASG GGGGASSSRW PKAEVHALIQ LRTELETRYQ  240
DSGPKGPLWE DISAGMRRLG YSRSSKRCKE KWENINKYFK KVKESNKKRP EDSKTCPYYH  300
QLDALYRTKA ANAAAAASAS PAPATTTVLA PVPLSQTPPH VDHGGSNGNG NGWASANNGG  360
GGSCSGGMQT KASNNGTATA GGLPVVSVAG GNGNGNGVAA TTDNKGSKQV PVAKETAGQR  420
QPQPLAMNHN YGNDRMADDM DSDSMDDDDD DDEFDDDEND DDDIGGGKMQ VQYETSSHFQ  480
RPQLQNQNVV VGRPNASGGG GGGAPTTPAG PPPPAATSGT SFLACVQ
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
13548RGGGGIGGGGGGGK
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.395760.0flower| leaf| panicle| stem
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO2976002280.0
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2418000.0AK241800.1 Oryza sativa Japonica Group cDNA, clone: J065208I24, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015628078.10.0PREDICTED: trihelix transcription factor GTL1
TrEMBLA2XBP80.0A2XBP8_ORYSI; Putative uncharacterized protein
STRINGBGIOSGA011584-PA0.0(Oryza sativa Indica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP60638175
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G76880.13e-49Trihelix family protein